Gene Information

Name : VC0826 (VC0826)
Accession : NP_230474.1
Strain :
Genome accession: NC_002505
Putative virulence/resistance : Virulence
Product : toxin co-regulated pilus biosynthesis protein P
Function : -
COG functional category : K : Transcription
COG ID : COG3710
EC number : -
Position : 888846 - 889511 bp
Length : 666 bp
Strand : +
Note : similar to GB:X74730 PID:398398; identified by sequence similarity

DNA sequence :
ATGGGGTATGTCCGCGTGATTTATCAATTTCCCGATAACCTTTGGTGGAATGAATGCACTAATCAAGTCTATTATGCACA
AGATCCAATGAAGCCAGAAAGGCTGATTGGTACACCAAGCATAATACAGACTAAGTTATTGAAAATACTCTGTGAATATC
ATCCTGCCCCCTGTCCAAATGATCAAATAATTAAAGCACTTTGGCCTCATGGATTTATCAGCTCTGAAAGTCTAACTCAG
GCAATCAAAAGAACCAGAGATTTTTTGAATGATGAACATAAGACGTTGATCGAAAATGTAAAGTTACAAGGTTATCGTAT
TAATATTATACAAGTTATTGTTTCTGAAAACGTTGTTGATGAAGCTGACTGTAGTCAAAAAAAATCAGTAAAAGAGCGGA
TAAAAATTGAGTGGGGGAAGATAAACGTAGTTCCTTATCTTGTTTTTTCGGCGCTTTATGTTGCTTTGCTACCTGTGATT
TGGTGGAGTTATGGCCAATGGTATCAACATGAATTAGCCGGCATTACTCATGATCTACGAGATTTAGCAAGGTTACCGGG
GATAACAATCCAAAAACTGTCAGAACAAAAACTCACGTTCGCTATTGATCAACATCAGTGTTCCGTGAATTATGAACAGA
AGACATTAGAATGCACAAAAAATTAA

Protein sequence :
MGYVRVIYQFPDNLWWNECTNQVYYAQDPMKPERLIGTPSIIQTKLLKILCEYHPAPCPNDQIIKALWPHGFISSESLTQ
AIKRTRDFLNDEHKTLIENVKLQGYRINIIQVIVSENVVDEADCSQKKSVKERIKIEWGKINVVPYLVFSALYVALLPVI
WWSYGQWYQHELAGITHDLRDLARLPGITIQKLSEQKLTFAIDQHQCSVNYEQKTLECTKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tcpP ACK75639.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 4e-101 100
VC0826 NP_230474.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI-1 Protein 6e-101 100
tcpP AAK20783.1 toxin-coregulated pilus biosynthesis protein P Virulence VPI Protein 4e-101 100
tcpP ACK75599.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 4e-101 100
tcpP ACK75614.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 4e-100 99
tcpP ACK75609.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 7e-100 98
tcpP AAK20753.1 toxin-coregulated pilus biosynthesis protein P Virulence VPI Protein 3e-100 98
tcpP ACK75629.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 3e-100 98
tcpP ACK75634.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 5e-99 98
tcpP CAA45453.1 - Virulence VPI Protein 3e-100 98
tcpP AAK07623.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 4e-99 98
tcpP AAK07624.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 2e-100 98
tcpP AAK07625.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 4e-99 98
tcpP ACK75604.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 2e-99 98
tcpP AAK07626.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 7e-100 98
tcpP YP_001216307.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI-1 Protein 5e-100 98
tcpP ACK75619.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 6e-99 97
tcpP ACK75624.1 toxin co-regulated pilus biosynthesis protein P Virulence VPI Protein 2e-91 96

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VC0826 NP_230474.1 toxin co-regulated pilus biosynthesis protein P VFG0089 Protein 2e-101 100