Gene Information

Name : VC0510 (VC0510)
Accession : NP_230161.1
Strain :
Genome accession: NC_002505
Putative virulence/resistance : Virulence
Product : DNA repair protein RadC-like protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 539531 - 540004 bp
Length : 474 bp
Strand : -
Note : similar to PID:1208991 GB:U00096 PID:1552815 PID:2367100; identified by sequence similarity

DNA sequence :
ATGAATCCCAAAACTTCCGAGTACCAAAAGCAGCAACGCTATCAGGAAAATGAAATCCTAGAGCATGCCGCTGAGATACT
AGCTAACCGCTACGTGCGTGGCGATGCCCTAACCAATCCTGATGCCACCAAAGAGTATGTACGCTGTAAGCTAGGCAGCT
ATGAACGTGAAGTGTTTGCCTTATTGCTACTGGATAACCAAAACCGACTGATTGAGTTTAAAGAGCTGTTTCAAGGAACG
GTGGATGCGGCCAGCGTTTACCCGCGAGAAGTGGTGAAAGCGGTGTTAGAAGTGAATGCCGCAGCAGTGATATTTGCCCA
TAACCATCCATCTGGAGACTCAACACCATCTCAAGCCGATAGACGAATAACAGAAAGACTCAAAGATACTTTAGCGCTGG
TGGATGTTCGCGTTCTCGACCATATCGTGACAGGCGATACCTGCACCTCATTTGCTGAAAGGGGGTGGTTATGA

Protein sequence :
MNPKTSEYQKQQRYQENEILEHAAEILANRYVRGDALTNPDATKEYVRCKLGSYEREVFALLLLDNQNRLIEFKELFQGT
VDAASVYPREVVKAVLEVNAAAVIFAHNHPSGDSTPSQADRRITERLKDTLALVDVRVLDHIVTGDTCTSFAERGWL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 3e-69 100
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-50 70
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 6e-50 70
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 2e-50 70
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 3e-21 54
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 2e-21 54
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 2e-21 54
unnamed AAL08475.1 unknown Not tested SRL Protein 2e-21 54
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 2e-21 54
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 1e-21 54
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 2e-20 53
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 2e-21 53
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 2e-21 53
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 2e-21 52
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 8e-21 52
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 2e-21 52
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 1e-21 52
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 2e-21 52
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 2e-21 52
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 2e-21 52
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 3e-21 52
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 2e-21 52
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 3e-21 52
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 7e-29 49
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 7e-21 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VC0510 NP_230161.1 DNA repair protein RadC-like protein VFG1119 Protein 2e-50 70
VC0510 NP_230161.1 DNA repair protein RadC-like protein VFG1528 Protein 9e-22 54
VC0510 NP_230161.1 DNA repair protein RadC-like protein VFG1066 Protein 8e-22 54
VC0510 NP_230161.1 DNA repair protein RadC-like protein VFG1617 Protein 1e-21 52
VC0510 NP_230161.1 DNA repair protein RadC-like protein VFG1678 Protein 9e-22 52
VC0510 NP_230161.1 DNA repair protein RadC-like protein VFG0660 Protein 8e-22 52