Name : VC0497 (VC0497) Accession : NP_230151.1 Strain : Genome accession: NC_002505 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 530402 - 530602 bp Length : 201 bp Strand : + Note : similar to SP:P12552 PID:15163 PID:15171; identified by sequence similarity DNA sequence : ATGAGATTTCTACGACTTAAAGACGTGATGTCACTAACAGGGTTAGGCCGTTCAACTATCTATAAGTTCATGGCAGATGA AACCGACTTTCCTAAAAGTGTGCCACTCGGTGGACGAGCGGTAGCTTGGGTCGAAAGTGAAATCGAGGAATGGATGGAAT CGCGTCTTAGTATGCGAGACAACCAAGAATCCTTTCAGTAA Protein sequence : MRFLRLKDVMSLTGLGRSTIYKFMADETDFPKSVPLGGRAVAWVESEIEEWMESRLSMRDNQESFQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-25 | 100 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-13 | 58 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-13 | 58 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-13 | 58 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 4e-09 | 50 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-09 | 50 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 2e-13 | 50 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-13 | 50 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-13 | 50 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-07 | 48 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 2e-07 | 44 |
ORF C109 | AAN62202.1 | phage-related protein | Not tested | PAGI-2(C) | Protein | 3e-08 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
VC0497 | NP_230151.1 | transcriptional regulator | VFG1118 | Protein | 1e-13 | 58 |
VC0497 | NP_230151.1 | transcriptional regulator | VFG1141 | Protein | 9e-14 | 50 |