Gene Information

Name : VC0497 (VC0497)
Accession : NP_230151.1
Strain :
Genome accession: NC_002505
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 530402 - 530602 bp
Length : 201 bp
Strand : +
Note : similar to SP:P12552 PID:15163 PID:15171; identified by sequence similarity

DNA sequence :
ATGAGATTTCTACGACTTAAAGACGTGATGTCACTAACAGGGTTAGGCCGTTCAACTATCTATAAGTTCATGGCAGATGA
AACCGACTTTCCTAAAAGTGTGCCACTCGGTGGACGAGCGGTAGCTTGGGTCGAAAGTGAAATCGAGGAATGGATGGAAT
CGCGTCTTAGTATGCGAGACAACCAAGAATCCTTTCAGTAA

Protein sequence :
MRFLRLKDVMSLTGLGRSTIYKFMADETDFPKSVPLGGRAVAWVESEIEEWMESRLSMRDNQESFQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-25 100
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 4e-13 58
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 3e-13 58
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 4e-13 58
unnamed CAA21398.1 - Not tested HPI Protein 4e-09 50
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 3e-09 50
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 2e-13 50
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 3e-13 50
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 3e-13 50
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 1e-07 48
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 2e-07 44
ORF C109 AAN62202.1 phage-related protein Not tested PAGI-2(C) Protein 3e-08 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VC0497 NP_230151.1 transcriptional regulator VFG1118 Protein 1e-13 58
VC0497 NP_230151.1 transcriptional regulator VFG1141 Protein 9e-14 50