
|
Name : rpmG (VC0219) Accession : NP_229876.1 Strain : Genome accession: NC_002505 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 226479 - 226646 bp Length : 168 bp Strand : + Note : 'in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of t DNA sequence : ATGGCTAAAGGCATTCGCGAAAAAATCCGCCTAGTATCATCTGCAGGTACAGGTCACTTCTACACCACTGATAAGAACAA GCGCAATATGCCTGGCAAGTTCGAGATCAAGAAATATGATCCTGTAGTTCGCCAGCACGTTGTGTACAAAGAAGCAAAAA TCAAGTAA Protein sequence : MAKGIREKIRLVSSAGTGHFYTTDKNKRNMPGKFEIKKYDPVVRQHVVYKEAKIK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 6e-06 | 41 |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 8e-06 | 41 |