|
Name : VC1809 (VC1809) Accession : NP_231443.1 Strain : Genome accession: NC_002505 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1952631 - 1952861 bp Length : 231 bp Strand : - Note : similar to SP:P12552 PID:15163 PID:15171; identified by sequence similarity DNA sequence : TTGCAACTAACCAACCTGAGAGGTGTGAATATGCCAGAGAACAACATTCGTTTGATCCGCTTTCGAGAAGTGCTAACTAT GACTGGTTTGTCACGCTCTAGTTTGTACCGATTTATTGAAGAAAACCAATTCCCGCCCCAAGTTCAACTGGGTGGTCGTG CTGTAGCTTGGGTAGAAGGCGAGGTGCAGGAGTGGATTGCTCAACGGATCACCAATCGTCGAATGGATTAG Protein sequence : MQLTNLRGVNMPENNIRLIRFREVLTMTGLSRSSLYRFIEENQFPPQVQLGGRAVAWVEGEVQEWIAQRITNRRMD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-30 | 100 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-30 | 100 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 5e-29 | 97 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 3e-13 | 50 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-11 | 45 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 45 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 45 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| VC1809 | NP_231443.1 | transcriptional regulator | VFG1141 | Protein | 4e-31 | 100 |
| VC1809 | NP_231443.1 | transcriptional regulator | VFG1118 | Protein | 9e-12 | 45 |
