Name : VC1785 (VC1785) Accession : NP_231420.1 Strain : Genome accession: NC_002505 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1935801 - 1936007 bp Length : 207 bp Strand : - Note : similar to PID:1196729; identified by sequence similarity DNA sequence : ATGGGACAACAAGACATAGGAGAACATCCCATGAGATTTCTGAAACTAAAAGAAGTAATGGAAAAGACCGCACTAAGCCG TTCAGCAATTTACCGAAAAATGAATGATGGCGAGTTTCCACAGTCGGTGAGCTTGGGAGAAAGGGCTATTGCCTGGGTGG AAAGCGAAGTGGATGAGTGGATGGACTTTTGTCTTAAACAGCGATGA Protein sequence : MGQQDIGEHPMRFLKLKEVMEKTALSRSAIYRKMNDGEFPQSVSLGERAIAWVESEVDEWMDFCLKQR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-27 | 100 |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-27 | 100 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-27 | 100 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 4e-13 | 58 |
PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 1e-08 | 49 |
unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 2e-09 | 46 |
unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 3e-09 | 46 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 45 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-11 | 45 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 1e-11 | 45 |
ORF C109 | AAN62202.1 | phage-related protein | Not tested | PAGI-2(C) | Protein | 2e-08 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
VC1785 | NP_231420.1 | transcriptional regulator | VFG1118 | Protein | 7e-28 | 100 |
VC1785 | NP_231420.1 | transcriptional regulator | VFG1141 | Protein | 9e-12 | 45 |