Gene Information

Name : ureA (UU434)
Accession : NP_078271.1
Strain : Ureaplasma parvum ATCC 700970
Genome accession: NC_002162
Putative virulence/resistance : Virulence
Product : urease subunit gamma
Function : -
COG functional category : E : Amino acid transport and metabolism
COG ID : COG0831
EC number : -
Position : 495857 - 496162 bp
Length : 306 bp
Strand : -
Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter

DNA sequence :
ATGAATCTATCATTAAGAGAAGTCCAAAAATTATTGATAACAGTTGCTGCTGACGTTGCAAGAAGACGTTTAGCTAGAGG
TTTAAAATTAAACTATTCAGAAGCTGTTGCTTTAATTACTGATCATGTAATGGAAGGGGCAAGAGATGGTAAGCTAGTTG
CTGACCTAATGCAATCTGCTCGTGAAGTACTACGTGTTGATCAAGTTATGGAAGGTGTAGATACAATGGTTAGTATAATT
CAAGTTGAAGTTACTTTCCCTGATGGTACTAAACTAGTTTCTGTACACGATCCAATTTACAAATAA

Protein sequence :
MNLSLREVQKLLITVAADVARRRLARGLKLNYSEAVALITDHVMEGARDGKLVADLMQSAREVLRVDQVMEGVDTMVSII
QVEVTFPDGTKLVSVHDPIYK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ureA YP_005682176.1 urease subunit gamma Not tested PiCp 7 Protein 9e-20 65
ureA YP_005684268.1 urease subunit gamma Not tested PiCp 7 Protein 9e-20 65
ureA YP_003784327.1 urease subunit gamma Not tested PiCp 7 Protein 9e-20 65
ureA YP_005686360.1 urease subunit gamma Not tested PiCp 7 Protein 9e-20 65
ureA NP_286678.1 urease subunit gamma Virulence TAI Protein 1e-20 64
ureA NP_287086.1 urease subunit gamma Not tested TAI Protein 1e-20 64