Gene Information

Name : pO157p15 (pO157p15)
Accession : NP_052621.1
Strain :
Genome accession: NC_002128
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 14347 - 14688 bp
Length : 342 bp
Strand : +
Note : hypothetical 12.7 kDa protein encoded in insertion element IS911; similar to SwissProt accession number P39213

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGCTCCAATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTTGTTGACCAGAACTACACGGTGGCAGATGCCGCCAAAGCTATGGATATCGGCCTTTCCACAATGACAAGAT
GGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAACACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGT
GAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAGAATGAAATATTAAAAAAGGCTACAACCGCGCTCTTGATGTCAGA
CTCCCTGAACAGTTCTCGATAA

Protein sequence :
MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDIGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIR
ELRKKLQRIEMENEILKKATTALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-40 99
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-40 99
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-35 95
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-38 93
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-33 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-33 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-33 72
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-33 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-33 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-33 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-33 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-33 72
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 71
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-24 60
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-25 58
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-25 58
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-27 58
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 9e-27 58
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 9e-27 58
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-21 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 46
tnpA CAB61575.1 transposase A Not tested HPI Protein 7e-20 45
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pO157p15 NP_052621.1 hypothetical protein VFG1485 Protein 9e-41 99
pO157p15 NP_052621.1 hypothetical protein VFG1123 Protein 2e-33 72
pO157p15 NP_052621.1 hypothetical protein VFG1553 Protein 4e-29 71
pO157p15 NP_052621.1 hypothetical protein VFG0784 Protein 3e-27 58
pO157p15 NP_052621.1 hypothetical protein VFG1566 Protein 1e-12 43