Gene Information

Name : DR_2225 (DR_2225)
Accession : NP_295947.1
Strain :
Genome accession: NC_001263
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2222118 - 2222693 bp
Length : 576 bp
Strand : +
Note : similar to PID:950682 percent identity: 79.58; identified by sequence similarity; putative

DNA sequence :
ATGGCACTTTCACTGCAAAAAGGCGGCAACATTTCTCTGAGCAAGCAGGACGCCAACCTGCAACGCATTCTGGTGGGGCT
GGGCTGGGACCCGCGTTCCACCGACGGCCAGCAATTCGACCTGGACGCCAGCGCGTTCCTGCTGACCAGCGGCGGCAAGG
TGCGCGGCGACCACGACTTCATTTTCTACAACCAGCTTCGTTCGGTGGACGGCAGCGTGGAGCACACCGGCGACAACCGC
GACGGCCAGGGCGAGGGCGACGACGAGGTCATCAAGATCAACCTGACGCAGGTGCCGGCCGAGGTGGAGCGAATCGCCGT
GAGCGTCACCATCGACCAGGCCGAGCAGCGCCGCCAGAACTTCGGTCAGGTGGGCGGCGCCTTTATCCGCATCGTCAACG
AGGACAACGGCCAGGAACTTACTCGCTACGACCTCGGTGAAGACTTTTCCACGGAAACCGCTGTCATTTTCGGTGAAGTG
TACCGGCACGGCGGCGAGTGGAAATTCCGCGCCGTCGGGCAGGGCTACACCGGGGGCCTGGGGCCGCTGGCGCGCAACTA
CGGCGTGAACGTCTGA

Protein sequence :
MALSLQKGGNISLSKQDANLQRILVGLGWDPRSTDGQQFDLDASAFLLTSGGKVRGDHDFIFYNQLRSVDGSVEHTGDNR
DGQGEGDDEVIKINLTQVPAEVERIAVSVTIDQAEQRRQNFGQVGGAFIRIVNEDNGQELTRYDLGEDFSTETAVIFGEV
YRHGGEWKFRAVGQGYTGGLGPLARNYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-68 74
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-63 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 68
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 59
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-53 59
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-53 59
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-54 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DR_2225 NP_295947.1 tellurium resistance protein TerD BAC0389 Protein 5e-63 66
DR_2225 NP_295947.1 tellurium resistance protein TerD BAC0390 Protein 9e-58 60