Gene Information

Name : DR_2221 (DR_2221)
Accession : NP_295943.1
Strain :
Genome accession: NC_001263
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2218248 - 2218823 bp
Length : 576 bp
Strand : +
Note : similar to PID:950682 percent identity: 81.68; identified by sequence similarity; putative

DNA sequence :
ATGGCAGTTTCTCTTTCCAAAGGCGGCAACGTTTCTCTTTCCAAGGAAGCCCCCGGGCTCACCGGCATCGTGGTCGGTCT
CGGCTGGGACCCCCGCGCCACCGACGGGCAGGCGTTCGACCTTGACGGCAGCGTCTTTTTGCTCGATGCCGGCGGCAAGG
TGCGCGGCGACAGCGATTTCATCTTTTACAACAACAAAACCAGCAGCGACGGCAGCGTCGAGCACACCGGCGACAACACC
ACCGGCGCGGGCGAAGGCGACGACGAGACCGTGAAGATCGACCTGAGCAAGGTGCCCGCCGACGTGGACAAGATCGCCGT
GTGCGTGACCATTCACGAGGCCGAGACGCGCAACCAGAACTTCGGTCAGGTCAGCAAGGCGTACATCCGCGTGATGAACC
AGACCGGCGGCGCCGAAATCGCCCGCTACGACCTGTCCGAAGACGCCAGCACCGACACCGCCATGATCTTCGGCGAGGTC
TACCGTCACGGCAGCGACTGGAAGTTCAAGGCCGTCGGGCAGGGCTACGCCGGGGGCCTCGCGCCGCTCGCCCGCAACTA
CGGCGTCAACGTCTGA

Protein sequence :
MAVSLSKGGNVSLSKEAPGLTGIVVGLGWDPRATDGQAFDLDGSVFLLDAGGKVRGDSDFIFYNNKTSSDGSVEHTGDNT
TGAGEGDDETVKIDLSKVPADVDKIAVCVTIHEAETRNQNFGQVSKAYIRVMNQTGGAEIARYDLSEDASTDTAMIFGEV
YRHGSDWKFKAVGQGYAGGLAPLARNYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-68 73
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 69
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 68
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-61 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-61 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-63 68

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DR_2221 NP_295943.1 tellurium resistance protein TerD BAC0390 Protein 4e-64 69
DR_2221 NP_295943.1 tellurium resistance protein TerD BAC0389 Protein 2e-62 68