|
Name : ssbB (BSU36310) Accession : NP_391512.2 Strain : Bacillus subtilis 168 Genome accession: NC_000964 Putative virulence/resistance : Unknown Product : single-stranded DNA-binding protein SsbB Function : - COG functional category : L : Replication, recombination and repair COG ID : COG0629 EC number : - Position : 3740206 - 3740547 bp Length : 342 bp Strand : - Note : Evidence 2a: Function of homologous gene experimentally demonstrated in an other organism; PubMedId: 14762004, 16009133, 16549871; Product type f : factor DNA sequence : ATGTTCAATCAGGTCATGCTTGTCGGACGTCTTACAAAAGATCCTGATCTTCGCTACACTTCCGCCGGTGCGGCAGTTGC ACATGTTACGCTCGCGGTGAACCGCAGCTTCAAGAATGCTTCAGGTGAAATCGAAGCTGATTACGTCAATTGCACACTTT GGAGAAAAACAGCTGAAAACACGGCGTTGTATTGCCAAAAAGGTTCTCTCGTCGGCGTAAGCGGACGGATTCAGACAAGA AGCTATGAAAACGAGGAAGGCGTTAACGTGTATGTAACAGAAGTGTTGGCTGACACTGTTCGTTTTATGGACCCTAAACC CCGGGAAAAAGCTGCTGATTGA Protein sequence : MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTR SYENEEGVNVYVTEVLADTVRFMDPKPREKAAD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAOV_0290 | YP_005735807.1 | Single-stranded DNA-binding protein, phage associated | Not tested | ¥ÕSa1 | Protein | 2e-26 | 61 |
| SH1792 | YP_253707.1 | single strand DNA binding protein | Not tested | ¥ÕSh1 | Protein | 2e-26 | 60 |
| SAOV_1081 | YP_005736576.1 | ssDNA-binding protein | Not tested | ¥ÕSa2 | Protein | 4e-26 | 59 |
| SAOV_1956c | YP_005737400.1 | Single-stranded DNA-binding protein, phage associated | Not tested | ¥ÕSa3 | Protein | 4e-25 | 59 |
| SAV0864 | NP_371388.1 | ssDNA-binding protein | Not tested | ¥ÕSa1 | Protein | 4e-26 | 59 |
| SAUSA300_1958 | YP_494609.1 | single-strand binding protein | Not tested | ¥ÕSa3 | Protein | 1e-26 | 57 |
| SAUSA300_1958 | YP_494609.1 | single-strand binding protein | Not tested | ¥ÕSa3 | Protein | 1e-26 | 57 |
| SAV1983 | NP_372507.1 | single-strand DNA-binding protein | Not tested | ¥ÕSa3 | Protein | 8e-27 | 57 |
| SEQ_0802 | YP_002746140.1 | single-strand binding protein | Not tested | ¥ÕSeq2 | Protein | 4e-27 | 54 |
| ssb-3 | NP_814291.1 | single-strand binding protein | Not tested | Not named | Protein | 6e-18 | 44 |
| ef0030 | AAM75236.1 | EF0030 | Not tested | Not named | Protein | 4e-18 | 44 |
