
|
Name : Rv1370c (Rv1370c) Accession : NP_215886.1 Strain : Mycobacterium tuberculosis H37Rv Genome accession: NC_000962 Putative virulence/resistance : Unknown Product : Putative transposase for insertion sequence element IS6110 (fragment) Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 1542929 - 1543255 bp Length : 327 bp Strand : - Note : Rv1370c, (MTCY02B12.04c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 transposase subunits e.g. Q50686|YIA4_MYCTU Insertion element IS6110 hypothetical 12.0 kDa protein (108 aa), fasta DNA sequence : ATGTCAGGTGGTTCATCGAGGAGGTACCCGCCGGAGCTGCGTGAGCGGGCGGTGCGGATGGTCGCAGAGATCCGCGGTCA GCACGATTCGGAGTGGGCAGCGATCAGTGAGGTCGCCCGTCTACTTGGTGTTGGCTGCGCGGAGACGGTGCGTAAGTGGG TGCGCCAGGCGCAGGTCGATGCCGGCGCACGGCCCGGGACCACGACCGAAGAATCCGCTGAGCTGAAGCGCTTGCGGCGG GACAACGCCGAATTGCGAAGGGCGAACGCGATTTTAAAGACCGCGTCGGCTTTCTTCGCGGCCGAGCTCGACCGGCCAGC ACGCTAA Protein sequence : MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRR DNAELRRANAILKTASAFFAAELDRPAR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| Z1199 | NP_286734.1 | hypothetical protein | Not tested | TAI | Protein | 1e-16 | 55 |
| Z1222 | NP_286757.1 | hypothetical protein | Not tested | TAI | Protein | 1e-16 | 55 |
| Z1639 | NP_287142.1 | hypothetical protein | Not tested | TAI | Protein | 1e-16 | 55 |
| Z1661 | NP_287163.1 | hypothetical protein | Not tested | TAI | Protein | 1e-16 | 55 |
| unnamed | CAD42084.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 5e-14 | 54 |
| unnamed | AAF09023.1 | unknown | Not tested | SHI-O | Protein | 2e-14 | 53 |
| tnpE | AAD44738.1 | TnpE | Not tested | SHI-2 | Protein | 2e-14 | 53 |
| IS629 | CAC37925.1 | hypothetical protein | Not tested | LEE | Protein | 3e-16 | 53 |
| IS629 | CAI43820.1 | hypothetical protein | Not tested | LEE | Protein | 3e-16 | 53 |
| IS629 | CAI43841.1 | hypothetical protein | Not tested | LEE | Protein | 3e-16 | 53 |
| ECO103_3584 | YP_003223442.1 | IS629 transposase OrfA | Not tested | LEE | Protein | 4e-16 | 53 |
| IS629 | CAI43908.1 | hypothetical protein 1 | Not tested | LEE | Protein | 3e-16 | 53 |
| S3184 | NP_838467.1 | IS629 orfA | Not tested | SHI-1 | Protein | 7e-14 | 52 |
| unnamed | AAL67399.1 | TnpE-like protein | Not tested | PAI II CFT073 | Protein | 5e-14 | 52 |
| SF2979 | NP_708753.1 | IS629 ORF1 | Not tested | SHI-1 | Protein | 7e-14 | 52 |
| unnamed | ADD91740.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 5e-14 | 52 |
| ECO111_3720 | YP_003236060.1 | putative IS629 transposase OrfA | Not tested | LEE | Protein | 8e-15 | 52 |
| S4062 | NP_839231.1 | IS629 orfA | Not tested | SHI-2 | Protein | 1e-12 | 52 |
| ECO111_3775 | YP_003236110.1 | putative IS629 transposase OrfA | Not tested | LEE | Protein | 8e-15 | 52 |
| Z4335 | NP_289560.1 | hypothetical protein | Not tested | OI-122 | Protein | 8e-15 | 52 |
| SF3706 | NP_709445.1 | IS629 ORF1 | Not tested | SHI-2 | Protein | 3e-13 | 52 |
| c5168 | NP_757016.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-14 | 52 |
| c5214 | NP_757062.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-14 | 52 |
| APECO1_3498 | YP_854313.1 | transposase; OrfA protein of insertion sequence IS629 | Not tested | PAI I APEC-O1 | Protein | 5e-13 | 52 |
| ORF_36 | AAZ04445.1 | conserved hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 3e-13 | 52 |
| c3596 | NP_755471.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 7e-12 | 51 |
| c5177 | NP_757025.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 7e-12 | 51 |
| ECUMN_3344 | YP_002414020.1 | transposase ORF A, IS629 | Not tested | Not named | Protein | 7e-12 | 51 |
| r13 | AAC61722.1 | R13 | Not tested | PAI I CFT073 | Protein | 5e-12 | 51 |
| unnamed | AAL67404.1 | R13-like protein | Not tested | PAI II CFT073 | Protein | 5e-12 | 51 |
| CDC7B_2036 | YP_005163477.1 | hypothetical protein | Not tested | Not named | Protein | 1e-14 | 45 |
| CDCE8392_1959 | YP_005134490.1 | hypothetical protein | Not tested | Not named | Protein | 5e-15 | 45 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Rv1370c | NP_215886.1 | Putative transposase for insertion sequence element IS6110 (fragment) | VFG1603 | Protein | 2e-14 | 54 |
| Rv1370c | NP_215886.1 | Putative transposase for insertion sequence element IS6110 (fragment) | VFG0606 | Protein | 8e-14 | 52 |
| Rv1370c | NP_215886.1 | Putative transposase for insertion sequence element IS6110 (fragment) | VFG0643 | Protein | 2e-14 | 52 |
| Rv1370c | NP_215886.1 | Putative transposase for insertion sequence element IS6110 (fragment) | VFG1717 | Protein | 2e-12 | 51 |