Gene Information

Name : soxS (b4062)
Accession : NP_418486.1
Strain : Escherichia coli K12
Genome accession: NC_000913
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional dual regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 4277060 - 4277383 bp
Length : 324 bp
Strand : -
Note : regulation of superoxide response regulon

DNA sequence :
ATGTCCCATCAGAAAATTATTCAGGATCTTATCGCATGGATTGACGAGCATATTGACCAGCCGCTTAACATTGATGTAGT
CGCAAAAAAATCAGGCTATTCAAAGTGGTACTTGCAACGAATGTTCCGCACGGTGACGCATCAGACGCTTGGCGATTACA
TTCGCCAACGCCGCCTGTTACTGGCCGCCGTTGAGTTGCGCACCACCGAGCGTCCGATTTTTGATATCGCAATGGACCTG
GGTTATGTCTCGCAGCAGACCTTCTCCCGCGTTTTCCGTCGGCAGTTTGATCGCACTCCCAGCGATTATCGCCACCGCCT
GTAA

Protein sequence :
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLLLAAVELRTTERPIFDIAMDL
GYVSQQTFSRVFRRQFDRTPSDYRHRL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-45 96
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 9e-22 51
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 9e-22 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS NP_418486.1 DNA-binding transcriptional dual regulator NC_002695.1.914293.p Protein 4e-47 100
soxS NP_418486.1 DNA-binding transcriptional dual regulator BAC0371 Protein 4e-47 100
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP000034.1.gene4505. Protein 7e-47 99
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP001138.1.gene4488. Protein 7e-46 96
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP001918.1.gene327.p Protein 6e-44 90
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP000647.1.gene4499. Protein 2e-43 89
soxS NP_418486.1 DNA-binding transcriptional dual regulator NC_010558.1.6276025. Protein 4e-22 51
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP001138.1.gene612.p Protein 5e-24 46
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP000647.1.gene1624. Protein 8e-20 43
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP001918.1.gene2033. Protein 1e-19 43
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP001138.1.gene1637. Protein 2e-19 42
soxS NP_418486.1 DNA-binding transcriptional dual regulator BAC0560 Protein 1e-19 42
soxS NP_418486.1 DNA-binding transcriptional dual regulator NC_002695.1.917339.p Protein 1e-19 42
soxS NP_418486.1 DNA-binding transcriptional dual regulator CP000034.1.gene1596. Protein 1e-19 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS NP_418486.1 DNA-binding transcriptional dual regulator VFG0585 Protein 6e-46 96
soxS NP_418486.1 DNA-binding transcriptional dual regulator VFG1038 Protein 4e-22 51