Gene Information

Name : qseB (b3025)
Accession : NP_417497.1
Strain : Escherichia coli K12
Genome accession: NC_000913
Putative virulence/resistance : Virulence
Product : quorum sensing DNA-binding response regulator in two-component regulatory system with QseC
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3169828 - 3170487 bp
Length : 660 bp
Strand : +
Note : putative 2-component transcriptional regulator

DNA sequence : 
ATGCGAATTTTACTGATAGAAGATGACATGCTGATTGGCGACGGCATCAAAACGGGCCTTAGTAAAATGGGTTTTAGCGT
CGACTGGTTTACACAAGGTCGTCAGGGAAAAGAGGCGCTTTATAGCGCACCTTATGATGCGGTGATCCTGGATTTAACCT
TACCAGGCATGGATGGTCGCGATATTTTGCGCGAATGGCGAGAAAAAGGTCAGCGTGAGCCGGTACTGATCCTGACCGCG
CGCGATGCGCTGGCGGAACGTGTAGAAGGGCTGCGTCTGGGAGCTGACGATTATCTGTGTAAACCTTTTGCGTTGATAGA
AGTCGCCGCCAGGCTGGAAGCTCTGATGCGCCGAACCAACGGCCAGGCCAGCAACGAGCTGCGCCACGGTAACGTCATGC
TCGACCCCGGCAAACGTATCGCCACGCTGGCTGGCGAACCCTTAACACTGAAACCAAAAGAATTTGCCCTGCTGGAATTA
CTGATGCGTAACGCTGGTCGGGTACTGTCGCGCAAACTGATTGAAGAGAAACTGTATACCTGGGACGAAGAGGTCACCAG
TAATGCCGTTGAAGTGCATGTGCATCATCTGCGACGCAAACTCGGTAGTGATTTTATTCGTACCGTGCATGGTATTGGTT
ACACATTAGGTGAGAAATGA

Protein sequence : 
MRILLIEDDMLIGDGIKTGLSKMGFSVDWFTQGRQGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGQREPVLILTA
RDALAERVEGLRLGADDYLCKPFALIEVAARLEALMRRTNGQASNELRHGNVMLDPGKRIATLAGEPLTLKPKEFALLEL
LMRNAGRVLSRKLIEEKLYTWDEEVTSNAVEVHVHHLRRKLGSDFIRTVHGIGYTLGEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-40 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC BAC0487 Protein 5e-40 44
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC BAC0083 Protein 8e-37 43
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC BAC0638 Protein 2e-30 43
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC BAC0347 Protein 3e-33 42
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC NC_002516.2.879194.p Protein 8e-31 41
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC BAC0308 Protein 8e-36 41
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC BAC0197 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC VFG0473 Protein 2e-40 47
qseB NP_417497.1 quorum sensing DNA-binding response regulator in two-component regulatory system with QseC VFG1390 Protein 1e-32 42