Gene Information

Name : yfjZ (b2645)
Accession : NP_417132.1
Strain : Escherichia coli K12
Genome accession: NC_000913
Putative virulence/resistance : Virulence
Product : CP4-57 prophage; antitoxin of the YpjF-YfjZ toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2777115 - 2777432 bp
Length : 318 bp
Strand : +
Note : -

DNA sequence :
ATGAGCAACACCACATGGGGCCTGCAGCGAGATATCACGCCGCGCCTGGGAGCACGTCTGGTGCAGGAGGGCAACCAGCT
GCACTATCTGGCTGACCGGGCCAGTATCACCGGTAAGTTTAGTGACGCCGAATGTCCTAAGCTGGATGTGGTATTTCCAC
ATTTTATCAGCCAGATAGAGTCGATGCTGACCACTGGTGAACTGAATCCCCGCCATGCCCAATGCGTCACCCTGTACCAC
AACGGTTTTACCTGCGAAGCCGATACTCTTGGTAGTTGCGGCTACGTATACATCGCTGTTTACCCCACTCAACGCTAA

Protein sequence :
MSNTTWGLQRDITPRLGARLVQEGNQLHYLADRASITGKFSDAECPKLDVVFPHFISQIESMLTTGELNPRHAQCVTLYH
NGFTCEADTLGSCGYVYIAVYPTQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 1e-27 71
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 6e-27 69
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 3e-27 68
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 1e-27 68
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 2e-27 68
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 2e-27 68
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 1e-27 68
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 2e-26 67
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 1e-25 67
unnamed AAL08477.1 unknown Not tested SRL Protein 3e-26 66
Z1220 NP_286755.1 structural protein Not tested TAI Protein 1e-25 66
Z1658 NP_287161.1 structural protein Not tested TAI Protein 1e-25 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yfjZ NP_417132.1 CP4-57 prophage; antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG1619 Protein 1e-27 68
yfjZ NP_417132.1 CP4-57 prophage; antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG0662 Protein 5e-28 68
yfjZ NP_417132.1 CP4-57 prophage; antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG1681 Protein 4e-26 67
yfjZ NP_417132.1 CP4-57 prophage; antitoxin of the YpjF-YfjZ toxin-antitoxin system VFG1068 Protein 1e-26 66