Gene Information

Name : ykfG (b0247)
Accession : NP_414781.1
Strain : Escherichia coli K12
Genome accession: NC_000913
Putative virulence/resistance : Virulence
Product : CP4-6 prophage; predicted DNA repair protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2003
EC number : -
Position : 264256 - 264732 bp
Length : 477 bp
Strand : -
Note : putative DNA repair protein

DNA sequence :
ATGAAACAGCTTTCCTTTTTACCCGGCGAGATGACGCCACAGGACCGGCGTCTCATTCAGCGGGCGCTCAGGGCTCTGGA
CCGCCACCTGCATGAGCCCGGCGTAGCCTTCACCTCTACCCACGCCGTACGTGAATGGCTGCGACTGCATATGGCCGCGC
TTGAGCGGGAAGAGTTCCGGGTGTTGTATCTGGACAACCAGAATCAGTTGATTGCCCATGAAACGCTCTTCACCGGCACG
ATTAACCGCACCGAGGTGCATCCCCGGGAGGTGGTCAAACGTGCTCTGCACTTCAACGCGGCGGCGGTGATACTCGCGCA
TAACCATCCTTCCGGCGAGACGACACCTAGCCAGGCCGACAAAACCCTCACGCAGCGACTGGTTCAGGTGCTTCAGCTGG
TGGATATCCGTGTCCCTGACCATCTGATTGTCGGTGGCAGGCAAATCTATTCGTTCGCAGAACACGGTCTGCTTTGA

Protein sequence :
MKQLSFLPGEMTPQDRRLIQRALRALDRHLHEPGVAFTSTHAVREWLRLHMAALEREEFRVLYLDNQNQLIAHETLFTGT
INRTEVHPREVVKRALHFNAAAVILAHNHPSGETTPSQADKTLTQRLVQVLQLVDIRVPDHLIVGGRQIYSFAEHGLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeS CAI43901.1 YeeS protein Not tested LEE Protein 7e-55 83
unnamed CAD66203.1 hypothetical protein Not tested PAI III 536 Protein 2e-54 82
Z1217 NP_286752.1 RadC family DNA repair protein Not tested TAI Protein 8e-54 82
yeeS AAZ04458.1 putative RadC-like protein Not tested PAI I APEC-O1 Protein 1e-54 82
yeeS YP_854323.1 radC-like protein YeeS Not tested PAI I APEC-O1 Protein 2e-54 82
c5152 NP_757000.1 radC-like protein yeeS Not tested PAI II CFT073 Protein 2e-54 82
z1217 CAD33787.1 Z1217 protein Not tested PAI I 536 Protein 3e-54 82
ECO103_3589 YP_003223446.1 radC-like protein YeeS Not tested LEE Protein 4e-55 82
yeeS ADD91702.1 YeeS Not tested PAI-I AL862 Protein 2e-54 82
aec73 AAW51756.1 Aec73 Not tested AGI-3 Protein 2e-54 82
yeeS NP_838484.1 RADC family DNA repair protein Not tested SHI-1 Protein 4e-54 82
yeeS CAE85201.1 YeeS protein Not tested PAI V 536 Protein 1e-54 82
yeeS NP_708770.1 RADC family DNA repair protein Not tested SHI-1 Protein 4e-54 82
unnamed AAL08475.1 unknown Not tested SRL Protein 6e-54 82
unnamed AAL67345.1 intergenic-region protein Not tested PAI II CFT073 Protein 6e-54 82
yeeS CAI43846.1 YeeS protein Not tested LEE Protein 2e-54 82
Z1657 NP_287160.1 RadC family DNA repair protein Not tested TAI Protein 2e-52 81
unnamed AAK00479.1 unknown Not tested SHI-1 Protein 3e-49 81
unnamed CAD42098.1 hypothetical protein Not tested PAI II 536 Protein 6e-53 81
VC0510 NP_230161.1 DNA repair protein RadC-like protein Not tested VSP-2 Protein 5e-19 54
VC1786 NP_231421.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-20 50
VC0395_A1383 YP_001217326.1 DNA repair protein RadC Not tested VPI-2 Protein 1e-20 50
VPI2_0034 ACA01849.1 DNA repair protein RadC Not tested VPI-2 Protein 8e-21 50
radC AAN62140.1 putative DNA repair protein RadC Not tested PAGI-2(C) Protein 1e-23 46
radC AAN62275.1 putative DNA repair protein RadC Not tested PAGI-3(SG) Protein 2e-21 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykfG NP_414781.1 CP4-6 prophage; predicted DNA repair protein VFG1528 Protein 1e-54 82
ykfG NP_414781.1 CP4-6 prophage; predicted DNA repair protein VFG1678 Protein 1e-54 82
ykfG NP_414781.1 CP4-6 prophage; predicted DNA repair protein VFG0660 Protein 1e-54 82
ykfG NP_414781.1 CP4-6 prophage; predicted DNA repair protein VFG1066 Protein 3e-54 82
ykfG NP_414781.1 CP4-6 prophage; predicted DNA repair protein VFG1617 Protein 3e-53 81
ykfG NP_414781.1 CP4-6 prophage; predicted DNA repair protein VFG1119 Protein 4e-21 50