Gene Information

Name : TM1655 (TM1655)
Accession : NP_229455.1
Strain : Thermotoga maritima MSB8
Genome accession: NC_000853
Putative virulence/resistance : Virulence
Product : response regulator DrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1644632 - 1645375 bp
Length : 744 bp
Strand : -
Note : similar to PID:1575577 GB:AE000512 percent identity: 100.00; identified by sequence similarity

DNA sequence :
GTGTACCCCCTCGGGGGATCGAAGATGGCGAAAAAGAAGATTCTGGTGGTTGACGACGACCCGGCAATTCTTGAGCTGGT
AGGATATAACCTTTCCAAGGAAGGATACGAGGTGCTCAAGGCTTATGATGGAGAGGAAGCACTCAAAATTGCCAACGACG
AAGACGTGGACATGTTCATAGTGGATATCATGCTTCCTGGAATCGACGGCTTCGAGCTGGTCAGGAAGATCAGATCCATG
GAGAAATACAAGAACACCCCCGTGATCTTCCTGAGCGCAAAGGGAGAAGAATTCGACAAGGTGCTTGGGCTGGAGCTCGG
TGCGGACGACTACATCACCAAGCCGTTCAGCGTGAGAGAGCTTCTTGCGAGGGTGAAGGCTATATTCAGAAGGCTTTCCA
CCGCTACTCAGAGCAAGGAAGAAAGGCCTAAGAAGATCATAGCCAAGGATCTTGAAATCGATGTGGAAAAGTACGAAGTG
AAAGTGAGAGGGAAAAAAGTGAACCTCACTCCTCTCGAATTTGAACTGCTCCGATTCCTCGCGGAAAACGAAGGAAAAGT
TTTCAGCAGGGATGTTCTTCTGGACAAACTCTGGGGATACGATTACTACGGAGATACGAGAACTGTAGATGTTCACATAA
GAAGGCTGAGAACGAAGATAGAAGAAGATCCTTCGAATCCGAAATACATAATCACTGTGAGAGGAAAGGGATACAAATTC
AGAGACCCCGGAAAGGAAGACTGA

Protein sequence :
MYPLGGSKMAKKKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGFELVRKIRSM
EKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRRLSTATQSKEERPKKIIAKDLEIDVEKYEV
KVRGKKVNLTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKF
RDPGKED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-44 48
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-44 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TM1655 NP_229455.1 response regulator DrrA NC_012469.1.7685629. Protein 3e-54 52
TM1655 NP_229455.1 response regulator DrrA HE999704.1.gene2815. Protein 1e-49 51
TM1655 NP_229455.1 response regulator DrrA AE016830.1.gene1681. Protein 3e-54 49
TM1655 NP_229455.1 response regulator DrrA NC_002952.2859905.p0 Protein 2e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_003923.1003749.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_002745.1124361.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_009782.5559369.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_002951.3237708.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_007622.3794472.p0 Protein 3e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_002758.1121668.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_009641.5332272.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_013450.8614421.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA NC_007793.3914279.p0 Protein 4e-49 48
TM1655 NP_229455.1 response regulator DrrA AF155139.2.orf0.gene Protein 8e-47 47
TM1655 NP_229455.1 response regulator DrrA NC_012469.1.7686381. Protein 2e-46 47
TM1655 NP_229455.1 response regulator DrrA AM180355.1.gene1830. Protein 7e-42 46
TM1655 NP_229455.1 response regulator DrrA NC_014475.1.orf0.gen Protein 2e-45 45
TM1655 NP_229455.1 response regulator DrrA NC_005054.2598277.p0 Protein 2e-45 45
TM1655 NP_229455.1 response regulator DrrA AE000516.2.gene3505. Protein 2e-40 44
TM1655 NP_229455.1 response regulator DrrA FJ349556.1.orf0.gene Protein 9e-44 43
TM1655 NP_229455.1 response regulator DrrA DQ212986.1.gene4.p01 Protein 3e-41 43
TM1655 NP_229455.1 response regulator DrrA AF130997.1.orf0.gene Protein 5e-38 43
TM1655 NP_229455.1 response regulator DrrA AF162694.1.orf4.gene Protein 2e-38 43
TM1655 NP_229455.1 response regulator DrrA BAC0125 Protein 3e-34 42
TM1655 NP_229455.1 response regulator DrrA NC_013450.8614146.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_002951.3238224.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_007793.3914065.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_002758.1121390.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_010079.5776364.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_002952.2859858.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_007622.3794948.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA NC_003923.1003417.p0 Protein 5e-36 41
TM1655 NP_229455.1 response regulator DrrA BAC0197 Protein 2e-33 41
TM1655 NP_229455.1 response regulator DrrA EU250284.1.orf4.gene Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TM1655 NP_229455.1 response regulator DrrA VFG1702 Protein 1e-44 48
TM1655 NP_229455.1 response regulator DrrA VFG1563 Protein 4e-44 47
TM1655 NP_229455.1 response regulator DrrA VFG1389 Protein 1e-33 43