
|
Name : rpmJ (CT786) Accession : NP_220305.1 Strain : Chlamydia trachomatis D/UW-3/CX Genome accession: NC_000117 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 921655 - 921792 bp Length : 138 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAGAGTTAGTTCATCCATCAAAGCAGACCCCTCAAAAGGTGACAAGCTTGTTCGTCGTAAGGGACGTCTTTATGTTAT TAACAAGAAAGATCCCAACCGTAAGCAGCGTCAAGCAGGGCCTGCTCGTAAGAAGTAA Protein sequence : MRVSSSIKADPSKGDKLVRRKGRLYVINKKDPNRKQRQAGPARKK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 0.019 | 50 |